Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POGZ Rabbit Polyclonal Antibody (HRP)

POGZ Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MRD37, WHSUS, ZNF635, ZNF280E, ZNF635m

UniProt

Q7Z3K3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human POGZ

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EELEPWQKISDVIEDSVVEDYNSVDKTTTVSVSQQPVSAPVPIAAHASVA

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

155kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_055915

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncoated Mouse TIMP-1 (Tissue Inhibitors of Metalloproteinase 1) ELISA Kit
E-UNEL-M0008-01 5x 96 Tests

Uncoated Mouse TIMP-1 (Tissue Inhibitors of Metalloproteinase 1) ELISA Kit

Sign In for Pricing
View Details
Uncoated Mouse TIMP-1 (Tissue Inhibitors of Metalloproteinase 1) ELISA Kit
E-UNEL-M0008-02 15x 96 Tests

Uncoated Mouse TIMP-1 (Tissue Inhibitors of Metalloproteinase 1) ELISA Kit

Sign In for Pricing
View Details
Mouse IL-5 Recombinant Rabbit monoclonal Antibody
HA725035 100 µL

Mouse IL-5 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CD31 (PECAM1) Mouse Monoclonal Antibody [Clone ID: C31.3 + JC/70A]
AM50225PU-T 20 µg

CD31 (PECAM1) Mouse Monoclonal Antibody [Clone ID: C31.3 + JC/70A]

Sign In for Pricing
View Details
Tissue Protein Lysate, Lung
CP565793 150 µg

Tissue Protein Lysate, Lung

Sign In for Pricing
View Details
Rat βTG/PBP/CXCL7/NAP2 Antibody Pair Set
E-KAB-0385 50 µL & 100 µg

Rat βTG/PBP/CXCL7/NAP2 Antibody Pair Set

Sign In for Pricing
View Details