Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POGZ Rabbit Polyclonal Antibody (HRP)

POGZ Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MRD37, WHSUS, ZNF635, ZNF280E, ZNF635m

UniProt

Q7Z3K3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human POGZ

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EELEPWQKISDVIEDSVVEDYNSVDKTTTVSVSQQPVSAPVPIAAHASVA

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

155kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_055915

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (T-Cell Marker) (rSPN/1094), 1mg/mL
BNUM1858-50 1x 50 µL

CD43 (T-Cell Marker) (rSPN/1094), 1mg/mL

Sign In for Pricing
View Details
Human Netrin 4 (NTN4) activation kit by CRISPRa
GA111816 1 Kit

Human Netrin 4 (NTN4) activation kit by CRISPRa

Sign In for Pricing
View Details
PDK1 (N-term) Rabbit Polyclonal Antibody
AP13579PU-N 400 µL

PDK1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1384), CF568 conjugate, 0.1mg/mL
BNC681384-500 1x 500 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1384), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Basic Protein (PRG2) Mouse Monoclonal Antibody [Clone ID: OTI1C12]
CF813063 100 µg

Major Basic Protein (PRG2) Mouse Monoclonal Antibody [Clone ID: OTI1C12]

Sign In for Pricing
View Details
Neurabin 1 Rabbit Polyclonal Antibody
HA500169 100 µL

Neurabin 1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details