Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POGZ Rabbit Polyclonal Antibody (Biotin)

POGZ Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MRD37, WHSUS, ZNF635, ZNF280E, ZNF635m

UniProt

Q7Z3K3

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human POGZ

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ASLEEQLKLSGEHSESSTPRPRSSPEETIEPESLHQLFEGESETESFYGF

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

155kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055915

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin-Linked Polyclonal Antibody to Fatty Acid Desaturase 3 (FADS3)
MBS2095972-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Fatty Acid Desaturase 3 (FADS3)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Fatty Acid Desaturase 3 (FADS3)
MBS2095972-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Fatty Acid Desaturase 3 (FADS3)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Fatty Acid Desaturase 3 (FADS3)
MBS2095972-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Fatty Acid Desaturase 3 (FADS3)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Fatty Acid Desaturase 3 (FADS3)
MBS2095972-04 1 mL

Biotin-Linked Polyclonal Antibody to Fatty Acid Desaturase 3 (FADS3)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Fatty Acid Desaturase 3 (FADS3)
MBS2095972-05 5 mL

Biotin-Linked Polyclonal Antibody to Fatty Acid Desaturase 3 (FADS3)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Fatty Acid Desaturase 3 (FADS3)
MBS2095972-06 5x 5 mL

Biotin-Linked Polyclonal Antibody to Fatty Acid Desaturase 3 (FADS3)

Sign In for Pricing
View Details