Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARC Rabbit Polyclonal Antibody (FITC)

ARC Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HArc, Arg3.1

UniProt

Q7LC44

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ARC

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ELDHRTSGGLHAYPGPRGGQVAKPNVILQIGKCRAEMLEHVRRTHRHLLA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Goat, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_056008

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ESR1 (ESR1, ESR, NR3A1, Estrogen receptor, ER-alpha, Estradiol receptor, Nuclear receptor subfamily 3 group A member 1) (Biotin) discontinued
035232-Biotin 200 µL

ESR1 (ESR1, ESR, NR3A1, Estrogen receptor, ER-alpha, Estradiol receptor, Nuclear receptor subfamily 3 group A member 1) (Biotin) discontinued

Sign In for Pricing
View Details
Human Anti-Candida albicans IgG, C. albicans IgG ELISA KIT
ED0049Hu 96 Well

Human Anti-Candida albicans IgG, C. albicans IgG ELISA KIT

Sign In for Pricing
View Details
RRM1 Protein Vector (Human) (pPB-C-His)
PV036373 500 ng

RRM1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
NUDT13 Rabbit Polyclonal Antibody (APC)
orb998939 100 µL

NUDT13 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
ApoE3, Recombinant, Human (Apoprotein E3)
A2299-76G1-01 100 µg

ApoE3, Recombinant, Human (Apoprotein E3)

Sign In for Pricing
View Details
ApoE3, Recombinant, Human (Apoprotein E3)
A2299-76G1-02 500 µg

ApoE3, Recombinant, Human (Apoprotein E3)

Sign In for Pricing
View Details