Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARC Rabbit Polyclonal Antibody (HRP)

ARC Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HArc, Arg3.1

UniProt

Q7LC44

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ARC

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ELDHRTSGGLHAYPGPRGGQVAKPNVILQIGKCRAEMLEHVRRTHRHLLA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Goat, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_056008

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NXF1 Recombinant Rabbit mAb
E43S47229 100 µL

NXF1 Recombinant Rabbit mAb

Sign In for Pricing
View Details
BAT4 (GPANK1) (NM_033177) Human Untagged Clone
SC123079 10 µg

BAT4 (GPANK1) (NM_033177) Human Untagged Clone

Sign In for Pricing
View Details
Abpd sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4335805 3x 1.0 µg

Abpd sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Thymidylate Synthase (dTMP synthase, TMS, TS, TSase, TYMS protein, Tyms thymidylate synthetase) (Biotin) discontinued
168872-AF-Biotin 100 µL

Thymidylate Synthase (dTMP synthase, TMS, TS, TSase, TYMS protein, Tyms thymidylate synthetase) (Biotin) discontinued

Sign In for Pricing
View Details
Anti-IRAK1BP1 Polyclonal Antibody
TMAB-07788-01 50 μL

Anti-IRAK1BP1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-IRAK1BP1 Polyclonal Antibody
TMAB-07788-02 100 µL

Anti-IRAK1BP1 Polyclonal Antibody

Sign In for Pricing
View Details