Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF793 Rabbit Polyclonal Antibody (HRP)

ZNF793 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q6ZN11

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF793

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KDVVVGFTQEEWHRLSPAQRALYRDVMLETYSNLASVGYEGTKPDVILRL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stat5a Mouse Monoclonal Antibody [Clone ID: 5F6.F1]
TA396763 1 mg

Stat5a Mouse Monoclonal Antibody [Clone ID: 5F6.F1]

Sign In for Pricing
View Details
RFX5 (NM_000449) Human Over-expression Lysate
LY424713 100 µg

RFX5 (NM_000449) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse GLP-1 (Glucagon Like Peptide 1) ELISA Kit
E-EL-M3108-01 24 Tests

Mouse GLP-1 (Glucagon Like Peptide 1) ELISA Kit

Sign In for Pricing
View Details
Mouse GLP-1 (Glucagon Like Peptide 1) ELISA Kit
E-EL-M3108-02 48 Tests

Mouse GLP-1 (Glucagon Like Peptide 1) ELISA Kit

Sign In for Pricing
View Details
Mouse GLP-1 (Glucagon Like Peptide 1) ELISA Kit
E-EL-M3108-03 96 Tests

Mouse GLP-1 (Glucagon Like Peptide 1) ELISA Kit

Sign In for Pricing
View Details
Bilirubin Microplate Assay Kit
RDSM150 100 Assays

Bilirubin Microplate Assay Kit

Sign In for Pricing
View Details