Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBTB7A Rabbit Polyclonal Antibody (HRP)

ZBTB7A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LRF, FBI1, FBI-1, TIP21, ZBTB7, ZNF857A, pokemon

UniProt

O95365

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZBTB7A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAGGVDGPIGIPFPDHSSDILSGLNEQRTQGLLCDVVILVEGREFPTHRS

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_056982

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Butropium Bromide
TRC-B690080-25MG 25 mg

Butropium Bromide

Sign In for Pricing
View Details
Cytokeratin 19 (A53-B/A2.26 + BA17), CF405S conjugate, 0.1mg/mL
BNC040753-100 1x 100 µL

Cytokeratin 19 (A53-B/A2.26 + BA17), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
St18 Mouse Gene Knockout Kit (CRISPR)
KN516795 1 Kit

St18 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Anti-Mouse 4-1BB (3H3) In Vivo Antibody - Low Endotoxin
ICH1036-50mg 50 mg

Anti-Mouse 4-1BB (3H3) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
Human SENP8 activation kit by CRISPRa
GA114804 1 Kit

Human SENP8 activation kit by CRISPRa

Sign In for Pricing
View Details
DDT Human Gene Knockout Kit (CRISPR)
KN202047RB 1 Kit

DDT Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details