Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zbtb7a Rabbit Polyclonal Antibody (HRP)

Zbtb7a Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

L, Lrf, Pok, FBI-, FBI-1, Zbtb7, Pokemon, AI452336, 9030619K07Rik, 9130006G12Rik

UniProt

O88939

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PPDVPAGAGAPPGLPDAPRNGQEKHFKDEEEDEEEASPDGSGRLNVAGSG

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_034861

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RRP12 Polyclonal Antibody
E-AB-90626-01 60 µL

RRP12 Polyclonal Antibody

Sign In for Pricing
View Details
RRP12 Polyclonal Antibody
E-AB-90626-02 120 µL

RRP12 Polyclonal Antibody

Sign In for Pricing
View Details
RRP12 Polyclonal Antibody
E-AB-90626-03 200 µL

RRP12 Polyclonal Antibody

Sign In for Pricing
View Details
ARID1B Human Gene Knockout Kit (CRISPR)
KN414830 1 Kit

ARID1B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
OR9G4 Human Gene Knockout Kit (CRISPR)
KN423384 1 Kit

OR9G4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ReadyStrain™ Cell Straining Kits
C5040 50 Units/Pack

ReadyStrain™ Cell Straining Kits

Sign In for Pricing
View Details