Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLHL5 Rabbit Polyclonal Antibody (Biotin)

KLHL5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q96PQ7

Immunogen

The immunogen is a synthetic peptide directed towards the n terminal region of human KLHL5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MSGSRKEFDVKQILKIRWRWFGHQASSPNSTVDSQQGEFWNRGQTGANGG

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

79kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001007076

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PNPLA3 Rabbit Monoclonal Antibody [Clone ID: OTIR2E4]
TA592964 100 µL

PNPLA3 Rabbit Monoclonal Antibody [Clone ID: OTIR2E4]

Sign In for Pricing
View Details
CYP27B1 Antibody - C-terminal region
ARP80645_P050-25UL 25 µL

CYP27B1 Antibody - C-terminal region

Sign In for Pricing
View Details
Lentiviral mouse Ston2 shRNA (UAS) - Lentiviral mouse Ston2 shRNA (UAS, iRFP) (25)
GTR15287690 1 Vial

Lentiviral mouse Ston2 shRNA (UAS) - Lentiviral mouse Ston2 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
SLC30A2 (NM_001004434) Human Tagged ORF Clone Lentiviral Particle
RC214242L4V 200 µL

SLC30A2 (NM_001004434) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Odf3 HDR Plasmid (m)
sc-427364-HDR 20 µg

Odf3 HDR Plasmid (m)

Sign In for Pricing
View Details
EFEMP1 Mouse Monoclonal Antibody [Clone ID: LBI1D9]
AMM11922V 100 µL

EFEMP1 Mouse Monoclonal Antibody [Clone ID: LBI1D9]

Sign In for Pricing
View Details