Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLHL5 Rabbit Polyclonal Antibody (HRP)

KLHL5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q96PQ7

Immunogen

The immunogen is a synthetic peptide directed towards the n terminal region of human KLHL5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSGSRKEFDVKQILKIRWRWFGHQASSPNSTVDSQQGEFWNRGQTGANGG

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

79kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001007076

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Myometrium
CB525774 1 Block

Frozen Tissue Blocks, Myometrium

Sign In for Pricing
View Details
Recombinant Human SLAMF6/Ly108 Protein (aa 28-225, His Tag)
PKSH033521-01 10 µg

Recombinant Human SLAMF6/Ly108 Protein (aa 28-225, His Tag)

Sign In for Pricing
View Details
Recombinant Human SLAMF6/Ly108 Protein (aa 28-225, His Tag)
PKSH033521-02 50 µg

Recombinant Human SLAMF6/Ly108 Protein (aa 28-225, His Tag)

Sign In for Pricing
View Details
Vitamin D Binding protein (GC) Mouse Monoclonal Antibody [Clone ID: OTI2A1]
CF809264 100 µg

Vitamin D Binding protein (GC) Mouse Monoclonal Antibody [Clone ID: OTI2A1]

Sign In for Pricing
View Details
1-Naphthyl b-D-glucopyranoside
TRC-N372060-250MG 250 mg

1-Naphthyl b-D-glucopyranoside

Sign In for Pricing
View Details
eIF1A (EIF1AX) (NM_001412) Human Over-expression Lysate
LC419951 20 µg

eIF1A (EIF1AX) (NM_001412) Human Over-expression Lysate

Sign In for Pricing
View Details