Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RTRAF Rabbit Polyclonal Antibody (Biotin)

RTRAF Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

2700060E02Rik

UniProt

Q9CQE8

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_080804

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Endoplasmic Reticulum-Golgi Intermediate Compartment (ERGIC) 1 (ERGIC1) Antibody
abx232839 100 µg

Endoplasmic Reticulum-Golgi Intermediate Compartment (ERGIC) 1 (ERGIC1) Antibody

Sign In for Pricing
View Details
Vwce 3'UTR Lenti-reporter-Luc Vector
50244086 1.0 µg

Vwce 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Wingless Type MMTV Integration Site Family, Member 2B (WNT2B)
MBS2083299-01 0.1 mL

HRP-Linked Polyclonal Antibody to Wingless Type MMTV Integration Site Family, Member 2B (WNT2B)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Wingless Type MMTV Integration Site Family, Member 2B (WNT2B)
MBS2083299-02 0.2 mL

HRP-Linked Polyclonal Antibody to Wingless Type MMTV Integration Site Family, Member 2B (WNT2B)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Wingless Type MMTV Integration Site Family, Member 2B (WNT2B)
MBS2083299-03 0.5 mL

HRP-Linked Polyclonal Antibody to Wingless Type MMTV Integration Site Family, Member 2B (WNT2B)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Wingless Type MMTV Integration Site Family, Member 2B (WNT2B)
MBS2083299-04 1 mL

HRP-Linked Polyclonal Antibody to Wingless Type MMTV Integration Site Family, Member 2B (WNT2B)

Sign In for Pricing
View Details