Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RTRAF Rabbit Polyclonal Antibody (HRP)

RTRAF Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

2700060E02Rik

UniProt

Q9CQE8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_080804

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAAR9 Rabbit Polyclonal Antibody
orb326688 100 µL

TAAR9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human COL4A2 shRNA (UAS) - Lentiviral human COL4A2 shRNA (UAS) plasmid
GTR15127447 1 Vial

Lentiviral human COL4A2 shRNA (UAS) - Lentiviral human COL4A2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
CTAGE6-set siRNA/shRNA/RNAi Lentivector (Human)
56004091 4x 500 ng

CTAGE6-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
SUMO-2/3 (HSMT3, Sentrin 2, Small Ubiquitin like Modifier 2, Small Ubiquitin like Modifier Protein 3, SMT3A, SMT3B, SMT3 Homolog 1, SMT3H1, SMT3 Homolog 2, SMT3H2, SMT3 Homolog, SMT3 Suppressor of mif two 3 Homolog 1, SMT3 Suppressor of mif two 3 Homolog 2, SMT3 Suppressor of mif two 3 Homolog 3, Suppressor of mif two 3 Homolog 2, Suppressor of mif two 3 Homolog 3, Ubiquitin like Protein SMT3A, Ubiquitin like Protein SMT3B) (Biotin)
172151-AF-Biotin 100 µL

SUMO-2/3 (HSMT3, Sentrin 2, Small Ubiquitin like Modifier 2, Small Ubiquitin like Modifier Protein 3, SMT3A, SMT3B, SMT3 Homolog 1, SMT3H1, SMT3 Homolog 2, SMT3H2, SMT3 Homolog, SMT3 Suppressor of mif two 3 Homolog 1, SMT3 Suppressor of mif two 3 Homolog 2, SMT3 Suppressor of mif two 3 Homolog 3, Suppressor of mif two 3 Homolog 2, Suppressor of mif two 3 Homolog 3, Ubiquitin like Protein SMT3A, Ubiquitin like Protein SMT3B) (Biotin)

Sign In for Pricing
View Details
Mouse Monoclonal FTO Antibody (FT62-6) [Alexa Fluor 532]
NBP2-80050AF532 0.1 mL

Mouse Monoclonal FTO Antibody (FT62-6) [Alexa Fluor 532]

Sign In for Pricing
View Details
F-Amidine
sc-496343B 5 mg

F-Amidine

Sign In for Pricing
View Details