Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Klf3 Rabbit Polyclonal Antibody (FITC)

Klf3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BKL, Bklf, Tef-2, AL024007, 9930027G08Rik

UniProt

Q60980

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Klf3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MLMFDPVPVKQEAMDPVSVSFPSNYIESMKPNKYGVIYSTPLPDKFFQTP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_032479

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM63C Protein Vector (Mouse) (pPB-C-His)
PV239810 500 ng

TMEM63C Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
GMEB1 (Glucocorticoid Modulatory Element-binding Protein 1, GMEB-1, DNA-binding Protein p96PIF, Parvovirus Initiation Factor p96, PIF p96) (MaxLight 750)
MBS6233061-01 0.1 mL

GMEB1 (Glucocorticoid Modulatory Element-binding Protein 1, GMEB-1, DNA-binding Protein p96PIF, Parvovirus Initiation Factor p96, PIF p96) (MaxLight 750)

Sign In for Pricing
View Details
GMEB1 (Glucocorticoid Modulatory Element-binding Protein 1, GMEB-1, DNA-binding Protein p96PIF, Parvovirus Initiation Factor p96, PIF p96) (MaxLight 750)
MBS6233061-02 5x 0.1 mL

GMEB1 (Glucocorticoid Modulatory Element-binding Protein 1, GMEB-1, DNA-binding Protein p96PIF, Parvovirus Initiation Factor p96, PIF p96) (MaxLight 750)

Sign In for Pricing
View Details
P53 Human Antibody (Detection) (Biotin)
orb1715996 0.1 mg

P53 Human Antibody (Detection) (Biotin)

Sign In for Pricing
View Details
CCL8 Antibody
orb1973090-01 20 µg

CCL8 Antibody

Sign In for Pricing
View Details
CCL8 Antibody
orb1973090-02 100 µg

CCL8 Antibody

Sign In for Pricing
View Details