Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERGIC2 Rabbit Polyclonal Antibody (HRP)

ERGIC2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PTX1, CDA14, Erv41, cd002

UniProt

Q96RQ1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ERGIC2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MRRLNRKKTLSLVKELDAFPKVPESYVETSASGGTVSLIAFTTMALLTIM

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057654

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kcnma1 ORF Vector (Rat) (pORF)
ORF068972 1.0 µg DNA

Kcnma1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
ZytoFast® 28S rRNA (+) Control Probe
ZTV-T-1120-100 100 µL

ZytoFast® 28S rRNA (+) Control Probe

Sign In for Pricing
View Details
Recombinant Interleukin 7 (IL7)
MBS2125449-01 0.01 mg

Recombinant Interleukin 7 (IL7)

Sign In for Pricing
View Details
Recombinant Interleukin 7 (IL7)
MBS2125449-02 0.05 mg

Recombinant Interleukin 7 (IL7)

Sign In for Pricing
View Details
Recombinant Interleukin 7 (IL7)
MBS2125449-03 0.1 mg

Recombinant Interleukin 7 (IL7)

Sign In for Pricing
View Details
Recombinant Interleukin 7 (IL7)
MBS2125449-04 0.2 mg

Recombinant Interleukin 7 (IL7)

Sign In for Pricing
View Details