Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERGIC2 Rabbit Polyclonal Antibody (Biotin)

ERGIC2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PTX1, CDA14, Erv41, cd002

UniProt

Q96RQ1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ERGIC2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TTGMLHGIGKFIVEIICCRFRLGSYKPVNSVPFEDGHTDNHLPLLENNTH

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_057654

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MPPED1, ID (MPPED1, C22orf1, FAM1A, Metallophosphoesterase domain-containing protein 1, Adult brain protein 239) (PE) discontinued
038571-PE 200 µL

MPPED1, ID (MPPED1, C22orf1, FAM1A, Metallophosphoesterase domain-containing protein 1, Adult brain protein 239) (PE) discontinued

Sign In for Pricing
View Details
Recombinant Human RPS2 Protein, N-His
orb2962705-01 50 µg

Recombinant Human RPS2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human RPS2 Protein, N-His
orb2962705-02 100 µg

Recombinant Human RPS2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human RPS2 Protein, N-His
orb2962705-03 1 mg

Recombinant Human RPS2 Protein, N-His

Sign In for Pricing
View Details
LMO1 (Rhombotin-1, Cysteine-rich Protein TTG-1, LIM Domain Only Protein 1, LMO-1, T-cell Translocation Protein 1, RBTN1, RHOM1, TTG1, MGC116692)
129139 100 µg

LMO1 (Rhombotin-1, Cysteine-rich Protein TTG-1, LIM Domain Only Protein 1, LMO-1, T-cell Translocation Protein 1, RBTN1, RHOM1, TTG1, MGC116692)

Sign In for Pricing
View Details
General Aldosterone (ALD) CLIA Kit
MBS2162078-01 24 Strip Well

General Aldosterone (ALD) CLIA Kit

Sign In for Pricing
View Details