Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERGIC2 Rabbit Polyclonal Antibody (FITC)

ERGIC2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PTX1, CDA14, Erv41, cd002

UniProt

Q96RQ1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ERGIC2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TTGMLHGIGKFIVEIICCRFRLGSYKPVNSVPFEDGHTDNHLPLLENNTH

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_057654

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSC70 monoclonal Antibody, Cy7 Conjugated
bsm-33211M-Cy7 100 µL

HSC70 monoclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
HSDL1 Protein Lysate
OCOA07758-20UG 20 µg

HSDL1 Protein Lysate

Sign In for Pricing
View Details
C9ORF50 Adenovirus (Human)
14808051 1.0 mL

C9ORF50 Adenovirus (Human)

Sign In for Pricing
View Details
Col18a1 3'UTR Luciferase Stable Cell Line
TU104168 1.0 mL

Col18a1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Human General transcription factor 3C polypeptide 5, GTF3C5 ELISA Kit
MBS9341653-01 48 Well

Human General transcription factor 3C polypeptide 5, GTF3C5 ELISA Kit

Sign In for Pricing
View Details
Human General transcription factor 3C polypeptide 5, GTF3C5 ELISA Kit
MBS9341653-02 96 Well

Human General transcription factor 3C polypeptide 5, GTF3C5 ELISA Kit

Sign In for Pricing
View Details