Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JMJD1B Rabbit Polyclonal Antibody (Biotin)

JMJD1B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

5qNCA, DIJOS, NET22, C5orf7, JMJD1B

UniProt

Q7LBC6

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human JMJD1B

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VHNLYSCIKVAEDFVSPEHVKHCFRLTQEFRHLSNTHTNHEDKLQVKNII

Field of Research

Metabolism Research

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

192kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057688

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GFP hsa-mir-1181 AAV miRNA Vector
Amh1003000 500 ng

GFP hsa-mir-1181 AAV miRNA Vector

Sign In for Pricing
View Details
CD134 IgG2a Fc, Fusion Protein (OX40) (Preservative Free)
MBS635145-01 0.025 mg

CD134 IgG2a Fc, Fusion Protein (OX40) (Preservative Free)

Sign In for Pricing
View Details
CD134 IgG2a Fc, Fusion Protein (OX40) (Preservative Free)
MBS635145-02 5x 0.025 mg

CD134 IgG2a Fc, Fusion Protein (OX40) (Preservative Free)

Sign In for Pricing
View Details
Toll Like Receptor 7 (TLR7), Recombinant, Mouse, His-Tag
054743-01 10 µg

Toll Like Receptor 7 (TLR7), Recombinant, Mouse, His-Tag

Sign In for Pricing
View Details
Toll Like Receptor 7 (TLR7), Recombinant, Mouse, His-Tag
054743-02 50 µg

Toll Like Receptor 7 (TLR7), Recombinant, Mouse, His-Tag

Sign In for Pricing
View Details
Toll Like Receptor 7 (TLR7), Recombinant, Mouse, His-Tag
054743-03 100 µg

Toll Like Receptor 7 (TLR7), Recombinant, Mouse, His-Tag

Sign In for Pricing
View Details