Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIX2 Rabbit Polyclonal Antibody (Biotin)

SIX2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q9NPC8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SIX2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: WSLPACEHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHAKLQ

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_058628

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin B1 (Phospho-S128) Antibody Blocking peptide
orb1449942 500 µg

Cyclin B1 (Phospho-S128) Antibody Blocking peptide

Sign In for Pricing
View Details
Arhgef15 3'UTR GFP Stable Cell Line
TU250853 1.0 mL

Arhgef15 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
KCNE1 (Potassium Voltage-gated Channel Subfamily E Member 1, Delayed Rectifier Potassium Channel Subunit IsK, IKs Producing Slow Voltage-gated Potassium Channel Subunit beta Mink, ISK, Minimal Potassium Channel, MinK, Potassium Voltage-gated Channel Isk-r
MBS625507-01 0.1 mL

KCNE1 (Potassium Voltage-gated Channel Subfamily E Member 1, Delayed Rectifier Potassium Channel Subunit IsK, IKs Producing Slow Voltage-gated Potassium Channel Subunit beta Mink, ISK, Minimal Potassium Channel, MinK, Potassium Voltage-gated Channel Isk-r

Sign In for Pricing
View Details
KCNE1 (Potassium Voltage-gated Channel Subfamily E Member 1, Delayed Rectifier Potassium Channel Subunit IsK, IKs Producing Slow Voltage-gated Potassium Channel Subunit beta Mink, ISK, Minimal Potassium Channel, MinK, Potassium Voltage-gated Channel Isk-r
MBS625507-02 5x 0.1 mL

KCNE1 (Potassium Voltage-gated Channel Subfamily E Member 1, Delayed Rectifier Potassium Channel Subunit IsK, IKs Producing Slow Voltage-gated Potassium Channel Subunit beta Mink, ISK, Minimal Potassium Channel, MinK, Potassium Voltage-gated Channel Isk-r

Sign In for Pricing
View Details
LCP1 Antibody
orb521128-01 50 μL

LCP1 Antibody

Sign In for Pricing
View Details
LCP1 Antibody
orb521128-02 100 µL

LCP1 Antibody

Sign In for Pricing
View Details