Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hoxb9 Rabbit Polyclonal Antibody (FITC)

Hoxb9 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Hox-2., Hox-2.5

UniProt

A2A9Z6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKMNKEQGKE

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_032296

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOCS-7 CRISPR Activation Plasmid (h)
sc-405246-ACT 20 µg

SOCS-7 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Recombinant Human Putative tubulin beta chain-like protein ENSP00000290377
MBS1115581-01 0.02 mg (E-Coli)

Recombinant Human Putative tubulin beta chain-like protein ENSP00000290377

Sign In for Pricing
View Details
Recombinant Human Putative tubulin beta chain-like protein ENSP00000290377
MBS1115581-02 0.02 mg (Yeast)

Recombinant Human Putative tubulin beta chain-like protein ENSP00000290377

Sign In for Pricing
View Details
Recombinant Human Putative tubulin beta chain-like protein ENSP00000290377
MBS1115581-03 0.1 mg (E-Coli)

Recombinant Human Putative tubulin beta chain-like protein ENSP00000290377

Sign In for Pricing
View Details
Recombinant Human Putative tubulin beta chain-like protein ENSP00000290377
MBS1115581-04 0.1 mg (Yeast)

Recombinant Human Putative tubulin beta chain-like protein ENSP00000290377

Sign In for Pricing
View Details
Recombinant Human Putative tubulin beta chain-like protein ENSP00000290377
MBS1115581-05 0.02 mg (Baculovirus)

Recombinant Human Putative tubulin beta chain-like protein ENSP00000290377

Sign In for Pricing
View Details