Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hoxb9 Rabbit Polyclonal Antibody (HRP)

Hoxb9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Hox-2., Hox-2.5

UniProt

A2A9Z6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKMNKEQGKE

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_032296

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LAX1 siRNA
abx902939-01 15 nmol

Human LAX1 siRNA

Sign In for Pricing
View Details
Human LAX1 siRNA
abx902939-02 30 nmol

Human LAX1 siRNA

Sign In for Pricing
View Details
HIV-p66/RT-p66 (group M, subtype B (isolate HXB2) Gag-Pol polyprotein Protein (His)
TMPY-04161-01 5 µg

HIV-p66/RT-p66 (group M, subtype B (isolate HXB2) Gag-Pol polyprotein Protein (His)

Sign In for Pricing
View Details
HIV-p66/RT-p66 (group M, subtype B (isolate HXB2) Gag-Pol polyprotein Protein (His)
TMPY-04161-02 10 µg

HIV-p66/RT-p66 (group M, subtype B (isolate HXB2) Gag-Pol polyprotein Protein (His)

Sign In for Pricing
View Details
HIV-p66/RT-p66 (group M, subtype B (isolate HXB2) Gag-Pol polyprotein Protein (His)
TMPY-04161-03 20 µg

HIV-p66/RT-p66 (group M, subtype B (isolate HXB2) Gag-Pol polyprotein Protein (His)

Sign In for Pricing
View Details
HIV-p66/RT-p66 (group M, subtype B (isolate HXB2) Gag-Pol polyprotein Protein (His)
TMPY-04161-04 50 µg

HIV-p66/RT-p66 (group M, subtype B (isolate HXB2) Gag-Pol polyprotein Protein (His)

Sign In for Pricing
View Details