Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLHL3 Rabbit Polyclonal Antibody (HRP)

KLHL3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PHA2D

UniProt

Q9UH77

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KLHL3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MEGESVKLSSQTLIQAGDDEKNQRTITVNPAHMGKAFKVMNELRSKQLLC

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_059111

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Zebrafish PR/PGR Antibody Picoband® HRP Conjugated
AZC9V3N7-HRP 100 µg/Vial

Anti-Zebrafish PR/PGR Antibody Picoband® HRP Conjugated

Sign In for Pricing
View Details
Recombinant Probable sensor-like histidine kinase YehU (yehU)
MBS7034343-01 0.02 mg

Recombinant Probable sensor-like histidine kinase YehU (yehU)

Sign In for Pricing
View Details
Recombinant Probable sensor-like histidine kinase YehU (yehU)
MBS7034343-02 0.1 mg

Recombinant Probable sensor-like histidine kinase YehU (yehU)

Sign In for Pricing
View Details
Recombinant Probable sensor-like histidine kinase YehU (yehU)
MBS7034343-03 5x 0.1 mg

Recombinant Probable sensor-like histidine kinase YehU (yehU)

Sign In for Pricing
View Details
Ribonuclease T2 (RNASET2) Magnetic Fluorescence Assay Kit
MBS2154841-01 96 Tests

Ribonuclease T2 (RNASET2) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Ribonuclease T2 (RNASET2) Magnetic Fluorescence Assay Kit
MBS2154841-02 5x 96 Tests

Ribonuclease T2 (RNASET2) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details