Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLHL3 Rabbit Polyclonal Antibody (HRP)

KLHL3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PHA2D

UniProt

Q9UH77

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KLHL3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MEGESVKLSSQTLIQAGDDEKNQRTITVNPAHMGKAFKVMNELRSKQLLC

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_059111

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 / MS4A1 (B-Cell Marker) (rIGEL/773), CF594 conjugate, 0.1mg/mL
BNC941829-500 1x 500 µL

CD20 / MS4A1 (B-Cell Marker) (rIGEL/773), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IL-10R1, Mouse (Interleukin-10 Receptor 1) (CD210) (1B1.3a), CF594 conjugate, 0.1mg/mL
BNC942001-100 1x 100 µL

IL-10R1, Mouse (Interleukin-10 Receptor 1) (CD210) (1B1.3a), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BOD Incubator BIBD-102
BIBD-102 1 Unit

BOD Incubator BIBD-102

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL
BNC040158-500 1x 500 µL

Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pgp9.5 (UCHL-1) (UCHL1/841), CF647 conjugate, 0.1mg/mL
BNC470841-100 1x 100 µL

Pgp9.5 (UCHL-1) (UCHL1/841), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/2754), CF640R conjugate, 0.1mg/mL
BNC402754-500 1x 500 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/2754), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details