Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POGK Rabbit Polyclonal Antibody (HRP)

POGK Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BASS2, KRBOX2, LST003

UniProt

Q9P215

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human POGK

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SSESIVQGFKKCHISSNLEEEDDVLWEIESELPGGGEPPKDCDTESMAES

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060012

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Aeromonas Salmonicida ASA_4383 Protein
VAng-Lsx1292-500gEcoli 500 µg (E. coli)

Recombinant Aeromonas Salmonicida ASA_4383 Protein

Sign In for Pricing
View Details
Dkk-1, 32-266aa, Recombinant, Human (Dickkopf 1, Dickkopf 1-like, Dickkopf Homolog 1, Dickkopf-related Protein 1, DKK 1, hDkk 1, SK)
MBS637523-01 0.01 mg

Dkk-1, 32-266aa, Recombinant, Human (Dickkopf 1, Dickkopf 1-like, Dickkopf Homolog 1, Dickkopf-related Protein 1, DKK 1, hDkk 1, SK)

Sign In for Pricing
View Details
Dkk-1, 32-266aa, Recombinant, Human (Dickkopf 1, Dickkopf 1-like, Dickkopf Homolog 1, Dickkopf-related Protein 1, DKK 1, hDkk 1, SK)
MBS637523-02 5x 0.01 mg

Dkk-1, 32-266aa, Recombinant, Human (Dickkopf 1, Dickkopf 1-like, Dickkopf Homolog 1, Dickkopf-related Protein 1, DKK 1, hDkk 1, SK)

Sign In for Pricing
View Details
HLA-C (C-8) Alexa Fluor® 790
sc-166088 AF790 200 µg/mL

HLA-C (C-8) Alexa Fluor® 790

Sign In for Pricing
View Details
TGIF (TGIF1) Human Over-expression Lysate
orb1374202 20 µg

TGIF (TGIF1) Human Over-expression Lysate

Sign In for Pricing
View Details
Sheep Anti calsequestrin antibody ELISA kit
GTR10433738 96 Well

Sheep Anti calsequestrin antibody ELISA kit

Sign In for Pricing
View Details