Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bnc2 Rabbit Polyclonal Antibody (FITC)

Bnc2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

5031434M05Rik, 8430420F16Rik

UniProt

Q8BMQ3

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GTLRVHYKTVHLREMHKCKVPGCNMMFSSVRSRNRHSQNPNLHKNIPFTS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

116kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_766458

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mycn Antibody
orb860550 2 mg

Mycn Antibody

Sign In for Pricing
View Details
Cortisol discontinued
470540 1 mg

Cortisol discontinued

Sign In for Pricing
View Details
Porcine Tumor necrosis factor-related apoptosis-inducing ligand 1 ELISA Kit
MBS745516-01 48 Well

Porcine Tumor necrosis factor-related apoptosis-inducing ligand 1 ELISA Kit

Sign In for Pricing
View Details
Porcine Tumor necrosis factor-related apoptosis-inducing ligand 1 ELISA Kit
MBS745516-02 96 Well

Porcine Tumor necrosis factor-related apoptosis-inducing ligand 1 ELISA Kit

Sign In for Pricing
View Details
Porcine Tumor necrosis factor-related apoptosis-inducing ligand 1 ELISA Kit
MBS745516-03 5x 96 Well

Porcine Tumor necrosis factor-related apoptosis-inducing ligand 1 ELISA Kit

Sign In for Pricing
View Details
Porcine Tumor necrosis factor-related apoptosis-inducing ligand 1 ELISA Kit
MBS745516-04 10x 96 Well

Porcine Tumor necrosis factor-related apoptosis-inducing ligand 1 ELISA Kit

Sign In for Pricing
View Details