Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bnc2 Rabbit Polyclonal Antibody (HRP)

Bnc2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

5031434M05Rik, 8430420F16Rik

UniProt

Q8BMQ3

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GTLRVHYKTVHLREMHKCKVPGCNMMFSSVRSRNRHSQNPNLHKNIPFTS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

116kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_766458

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UNC45B Conjugated Antibody
orb1616742 100 µL

UNC45B Conjugated Antibody

Sign In for Pricing
View Details
RGS13, ID (RGS13, Regulator of G-protein signaling 13) (Biotin) discontinued
041004-Biotin 200 µL

RGS13, ID (RGS13, Regulator of G-protein signaling 13) (Biotin) discontinued

Sign In for Pricing
View Details
Falcon 96 Well 3um Multipack Fluoroblock Insert System With Dish
351162 5 / PCK

Falcon 96 Well 3um Multipack Fluoroblock Insert System With Dish

Sign In for Pricing
View Details
Rat IL-18 ELISA Kit
FM-E100165-01 1 Each

Rat IL-18 ELISA Kit

Sign In for Pricing
View Details
Rat IL-18 ELISA Kit
FM-E100165-02 1 Each

Rat IL-18 ELISA Kit

Sign In for Pricing
View Details
Collection Tubes (2 mL) (1000 Pack)
C1001-1000 1000 Pieces

Collection Tubes (2 mL) (1000 Pack)

Sign In for Pricing
View Details