Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGD1563533 Rabbit Polyclonal Antibody (Biotin)

RGD1563533 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RGD1563533

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PQMPQIPSSVPHLPTSPLATTSLESAKPQVKPGFLQFQDNDPCLATDCKY

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

196kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_002726704

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Leptin Antibody
E38PA6011 100 µL

Leptin Antibody

Sign In for Pricing
View Details
Akip1 (NM_020616) Mouse Recombinant Protein
TP516890 20 µg

Akip1 (NM_020616) Mouse Recombinant Protein

Sign In for Pricing
View Details
Mouse Pregnancy-Associated Glycoprotein 1 (PAG1) ELISA Kit
MBS9938615-01 48 Well

Mouse Pregnancy-Associated Glycoprotein 1 (PAG1) ELISA Kit

Sign In for Pricing
View Details
Mouse Pregnancy-Associated Glycoprotein 1 (PAG1) ELISA Kit
MBS9938615-02 96 Well

Mouse Pregnancy-Associated Glycoprotein 1 (PAG1) ELISA Kit

Sign In for Pricing
View Details
Mouse Pregnancy-Associated Glycoprotein 1 (PAG1) ELISA Kit
MBS9938615-03 5x 96 Well

Mouse Pregnancy-Associated Glycoprotein 1 (PAG1) ELISA Kit

Sign In for Pricing
View Details
Mouse Pregnancy-Associated Glycoprotein 1 (PAG1) ELISA Kit
MBS9938615-04 10x 96 Well

Mouse Pregnancy-Associated Glycoprotein 1 (PAG1) ELISA Kit

Sign In for Pricing
View Details