Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGD1563533 Rabbit Polyclonal Antibody (Biotin)

RGD1563533 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RGD1563533

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PQMPQIPSSVPHLPTSPLATTSLESAKPQVKPGFLQFQDNDPCLATDCKY

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

196kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_002726704

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCMV-SPORT6-CPN1 Plasmid
PVT34685 2 µg

pCMV-SPORT6-CPN1 Plasmid

Sign In for Pricing
View Details
ACTL5 AAV siRNA Pooled Vector
52395161 1.0 µg

ACTL5 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
DCNP1 CRISPR Activation Plasmid (h2)
sc-414508-ACT-2 20 µg

DCNP1 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
CLPB AAV siRNA Pooled Vector
16370161 1.0 µg

CLPB AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Set1/Ash2 histone Methyltransferase complex subunit ASH2
334018-01 50 µg

Set1/Ash2 histone Methyltransferase complex subunit ASH2

Sign In for Pricing
View Details
Set1/Ash2 histone Methyltransferase complex subunit ASH2
334018-02 100 µg

Set1/Ash2 histone Methyltransferase complex subunit ASH2

Sign In for Pricing
View Details