Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGD1563533 Rabbit Polyclonal Antibody (FITC)

RGD1563533 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RGD1563533

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PQMPQIPSSVPHLPTSPLATTSLESAKPQVKPGFLQFQDNDPCLATDCKY

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

196kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_002726704

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Presenilin 2 Rabbit pAb, PE-Cy5.5 conjugated
orb2843718 100 µL

Presenilin 2 Rabbit pAb, PE-Cy5.5 conjugated

Sign In for Pricing
View Details
Raf-1 CRISPR Activation Plasmid (m2)
sc-430995-ACT-2 20 µg

Raf-1 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
MGC34034 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV810729 1.0 µg DNA

MGC34034 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Doc2a 3'UTR Lenti-reporter-Luc Vector
18487086 1.0 µg

Doc2a 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
RNF105 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2449122 100 µL

RNF105 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Chicken Cation channel sperm-associated protein 2 (CATSPER2) ELISA Kit
MBS7235177-01 48 Well

Chicken Cation channel sperm-associated protein 2 (CATSPER2) ELISA Kit

Sign In for Pricing
View Details