Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGD1563533 Rabbit Polyclonal Antibody (FITC)

RGD1563533 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RGD1563533

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PQMPQIPSSVPHLPTSPLATTSLESAKPQVKPGFLQFQDNDPCLATDCKY

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

196kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_002726704

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr527 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4167607 1.0 µg DNA

Olfr527 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Normetanephrine Plasma ELISA Kit
DEE8200 96 Tests

Normetanephrine Plasma ELISA Kit

Sign In for Pricing
View Details
Tau Monoclonal Antibody, AbBy Fluor™ 750 Conjugated
bsm-33332M-BF750 100 µL

Tau Monoclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
8-Arm PEG-SH (MW 20000)
orb3137215-01 50 mg

8-Arm PEG-SH (MW 20000)

Sign In for Pricing
View Details
8-Arm PEG-SH (MW 20000)
orb3137215-02 10 mg

8-Arm PEG-SH (MW 20000)

Sign In for Pricing
View Details
CYCSP5 CRISPR All-in-one AAV vector set (with saCas9)(Human)
17288151 3x 1.0 µg DNA

CYCSP5 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details