Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGD1563533 Rabbit Polyclonal Antibody (HRP)

RGD1563533 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RGD1563533

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PQMPQIPSSVPHLPTSPLATTSLESAKPQVKPGFLQFQDNDPCLATDCKY

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

196kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_002726704

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ece1 (Endothelin Converting Enzyme 1) ELISA Kit
FY-EM3207 96 Well

Mouse Ece1 (Endothelin Converting Enzyme 1) ELISA Kit

Sign In for Pricing
View Details
CD23 Polyclonal Antibody
bs-2490R-TR 20 µL

CD23 Polyclonal Antibody

Sign In for Pricing
View Details
B3GALNT2 Antibody
orb1320929-01 30 µL

B3GALNT2 Antibody

Sign In for Pricing
View Details
B3GALNT2 Antibody
orb1320929-02 50 μL

B3GALNT2 Antibody

Sign In for Pricing
View Details
B3GALNT2 Antibody
orb1320929-03 100 µL

B3GALNT2 Antibody

Sign In for Pricing
View Details
CASC3 Antibody - N-terminal region : Biotin (ARP54817_P050-Biotin)
ARP54817_P050-Biotin 100 µL

CASC3 Antibody - N-terminal region : Biotin (ARP54817_P050-Biotin)

Sign In for Pricing
View Details