Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTBD2 Rabbit Polyclonal Antibody (Biotin)

BTBD2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q9BX70

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human BTBD2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NYTACATLKGPDSHYGTKGLRKVTHESPTTGAKTCFTFCYAAGNNNGTSV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060267

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zcchc17 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3590205 3x 1.0 µg

Zcchc17 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Recombinant Pseudomonas syringae pv. tomato Probable M18 family aminopeptidase 2 (apeB)
MBS1345680-01 0.02 mg (E-Coli)

Recombinant Pseudomonas syringae pv. tomato Probable M18 family aminopeptidase 2 (apeB)

Sign In for Pricing
View Details
Recombinant Pseudomonas syringae pv. tomato Probable M18 family aminopeptidase 2 (apeB)
MBS1345680-02 0.02 mg (Yeast)

Recombinant Pseudomonas syringae pv. tomato Probable M18 family aminopeptidase 2 (apeB)

Sign In for Pricing
View Details
Recombinant Pseudomonas syringae pv. tomato Probable M18 family aminopeptidase 2 (apeB)
MBS1345680-03 0.1 mg (E-Coli)

Recombinant Pseudomonas syringae pv. tomato Probable M18 family aminopeptidase 2 (apeB)

Sign In for Pricing
View Details
Recombinant Pseudomonas syringae pv. tomato Probable M18 family aminopeptidase 2 (apeB)
MBS1345680-04 0.1 mg (Yeast)

Recombinant Pseudomonas syringae pv. tomato Probable M18 family aminopeptidase 2 (apeB)

Sign In for Pricing
View Details
Recombinant Pseudomonas syringae pv. tomato Probable M18 family aminopeptidase 2 (apeB)
MBS1345680-05 0.02 mg (Baculovirus)

Recombinant Pseudomonas syringae pv. tomato Probable M18 family aminopeptidase 2 (apeB)

Sign In for Pricing
View Details