Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF446 Rabbit Polyclonal Antibody (Biotin)

ZNF446 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ZSCAN30, ZSCAN52, ZKSCAN20

UniProt

Q9NWS9

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF446

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SYPCEECGCSFSWKSQLVIHRKSHTGQRRHFCSDCGRAFDWKSQLVIHRK

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060378

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NK1.1 Cell Surface Antigen (Killer Cell Lectin-like Receptor Subfamily B Member 1C, CD161 Antigen-like Family Member C, Lymphocyte Antigen 55c, Ly-55c, NKR-P1.9, NKR-P1C, Natural Killer Cell Surface Protein P1-40, NKR-P1 40, CD161c, Klrb1c, Ly55c, Nkrp1c) (Biotin) discontinued
N2851-75F 500 µg

NK1.1 Cell Surface Antigen (Killer Cell Lectin-like Receptor Subfamily B Member 1C, CD161 Antigen-like Family Member C, Lymphocyte Antigen 55c, Ly-55c, NKR-P1.9, NKR-P1C, Natural Killer Cell Surface Protein P1-40, NKR-P1 40, CD161c, Klrb1c, Ly55c, Nkrp1c) (Biotin) discontinued

Sign In for Pricing
View Details
Ceramide synthase 2 (CERS2) (NM_181746) Human Untagged Clone
SC110411 10 µg

Ceramide synthase 2 (CERS2) (NM_181746) Human Untagged Clone

Sign In for Pricing
View Details
TIM3 / HAVCR2 / CD366 (Effector T-Cell Marker) (HAVCR2/192), CF740 conjugate, 0.1mg/mL
BNC742399-100 1x 100 µL

TIM3 / HAVCR2 / CD366 (Effector T-Cell Marker) (HAVCR2/192), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Anti-TNR27 antibody
STJ192277 200 µl

Anti-TNR27 antibody

Sign In for Pricing
View Details
GCS1 Rabbit Polyclonal Antibody (BF555)
orb2525643 100 µL

GCS1 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
Solithromycin 50mg
A14031-50 50 mg

Solithromycin 50mg

Sign In for Pricing
View Details