Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM68 Rabbit Polyclonal Antibody (HRP)

TRIM68 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SS56, GC109, SS-56, RNF137

UniProt

Q6AZZ1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TRIM68

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VIRLRKGNEYRAGTDEYPILSLPVPPRRVGIFVDYEAHDISFYNVTDCGS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_060543

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nori® Human 2-Plex ELISA Kits-MMP1/Pro-C3
GR230142 96 Well

Nori® Human 2-Plex ELISA Kits-MMP1/Pro-C3

Sign In for Pricing
View Details
TBX15, NT (TBX15, TBX14, T-box transcription factor TBX15, T-box transcription factor TBX14) (Biotin) discontinued
042664-Biotin 200 µL

TBX15, NT (TBX15, TBX14, T-box transcription factor TBX15, T-box transcription factor TBX14) (Biotin) discontinued

Sign In for Pricing
View Details
BTG3 Rabbit pAb
orb2719340-01 50 µL

BTG3 Rabbit pAb

Sign In for Pricing
View Details
BTG3 Rabbit pAb
orb2719340-02 100 µL

BTG3 Rabbit pAb

Sign In for Pricing
View Details
Multiplex Assay Kit for Epidermal Growth Factor (EGF), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0026493 96 Tests

Multiplex Assay Kit for Epidermal Growth Factor (EGF), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
Iron Colorimetric Microplate Assay Kit
CAK1106 100 Assays

Iron Colorimetric Microplate Assay Kit

Sign In for Pricing
View Details