Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PBRM1 Rabbit Polyclonal Antibody (Biotin)

PBRM1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PB1, BAF180

UniProt

Q86U86

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PBRM1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRN

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

99kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_851384

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beta glucuronidase Recombinant Antibody, Cy5.5 Conjugated
bsm-62371R-Cy5.5 100 µL

Beta glucuronidase Recombinant Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Human PDGFRβ (Platelet Derived Growth Factor Receptor Beta) ELISA Kit
EKE60628-01 96 Tests

Human PDGFRβ (Platelet Derived Growth Factor Receptor Beta) ELISA Kit

Sign In for Pricing
View Details
Human PDGFRβ (Platelet Derived Growth Factor Receptor Beta) ELISA Kit
EKE60628-02 5x 96 Tests

Human PDGFRβ (Platelet Derived Growth Factor Receptor Beta) ELISA Kit

Sign In for Pricing
View Details
Recombinant Mouse LEPR (C-10His)
C02Y-01 10 µg

Recombinant Mouse LEPR (C-10His)

Sign In for Pricing
View Details
Recombinant Mouse LEPR (C-10His)
C02Y-02 50 µg

Recombinant Mouse LEPR (C-10His)

Sign In for Pricing
View Details
Recombinant Mouse LEPR (C-10His)
C02Y-03 500 µg

Recombinant Mouse LEPR (C-10His)

Sign In for Pricing
View Details