Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PBRM1 Rabbit Polyclonal Antibody (HRP)

PBRM1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PB1, BAF180

UniProt

Q86U86

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PBRM1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SAESNSISKWDQTLAARRRDVHLSKEQESRLPSHWLKSKGAHTTMADALW

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

181kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060783

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

beta 2 Adrenergic Receptor (ADRB2) Human Gene Knockout Kit (CRISPR)
KN204499RB 1 Kit

beta 2 Adrenergic Receptor (ADRB2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PD1, Mouse (RMP1-14), 0.2mg/mL
BNUB2002-500 1x 500 µL

PD1, Mouse (RMP1-14), 0.2mg/mL

Sign In for Pricing
View Details
TREM2 Mouse Monoclonal Antibody [Clone ID: 2B5]
AM09045PU-S 50 µL

TREM2 Mouse Monoclonal Antibody [Clone ID: 2B5]

Sign In for Pricing
View Details
Di-n-hexyl Phthalate
TRC-D446490-1G 1 g

Di-n-hexyl Phthalate

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Pan T Cells,  20nm
GM-25-20 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Pan T Cells, 20nm

Sign In for Pricing
View Details
PCCB Rabbit Polyclonal Antibody
TA366707 100 µL

PCCB Rabbit Polyclonal Antibody

Sign In for Pricing
View Details