Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFP64 Rabbit Polyclonal Antibody (Biotin)

ZFP64 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ZNF338

UniProt

Q9NPA5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP64

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MNASSEGESFAGSVQIPGGTTVLVELTPDIHICGICKQQFNNLDAFVAHK

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_071371

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti Plant Defensin Beta Pab
272067 100 µg

Anti Plant Defensin Beta Pab

Sign In for Pricing
View Details
PCSK2 (Neuroendocrine Convertase 2, NEC 2, KEX2-like Endoprotease 2, Prohormone Convertase 2, Proprotein Convertase 2, PC2, NEC2) (AP)
MBS6388646-01 0.1 mL

PCSK2 (Neuroendocrine Convertase 2, NEC 2, KEX2-like Endoprotease 2, Prohormone Convertase 2, Proprotein Convertase 2, PC2, NEC2) (AP)

Sign In for Pricing
View Details
PCSK2 (Neuroendocrine Convertase 2, NEC 2, KEX2-like Endoprotease 2, Prohormone Convertase 2, Proprotein Convertase 2, PC2, NEC2) (AP)
MBS6388646-02 5x 0.1 mL

PCSK2 (Neuroendocrine Convertase 2, NEC 2, KEX2-like Endoprotease 2, Prohormone Convertase 2, Proprotein Convertase 2, PC2, NEC2) (AP)

Sign In for Pricing
View Details
GTPBP9 Rabbit pAb, Pacific Blue conjugated
orb2887143 100 µL

GTPBP9 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
Standard Gold Medal Matrix Adhesive
82704 10 mL

Standard Gold Medal Matrix Adhesive

Sign In for Pricing
View Details
ADH2 Antibody
orb837292 2 mg

ADH2 Antibody

Sign In for Pricing
View Details