Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFP64 Rabbit Polyclonal Antibody (Biotin)

ZFP64 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ZNF338

UniProt

Q9NPA5

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZFP64

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SDGGQNIAVATTAPPVFSSSSQQELPKQTYSIIQGAAHPALLCPADSIPD

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_071371

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1457 Recombinant Protein (Mouse)
RP157061 100 µg

Olfr1457 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Nup88 rabbit pAb Antibody
orb766678-01 50 μL

Nup88 rabbit pAb Antibody

Sign In for Pricing
View Details
Nup88 rabbit pAb Antibody
orb766678-02 100 µL

Nup88 rabbit pAb Antibody

Sign In for Pricing
View Details
Acetone 99% Extrapure
00027 00500 500 mL

Acetone 99% Extrapure

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Eukaryotic Translation Initiation Factor 4E Binding Protein 1 (EIF4EBP1)
TRV-0024858-01 200 µL

Biotin-Linked Polyclonal Antibody to Eukaryotic Translation Initiation Factor 4E Binding Protein 1 (EIF4EBP1)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Eukaryotic Translation Initiation Factor 4E Binding Protein 1 (EIF4EBP1)
TRV-0024858-02 1 mL

Biotin-Linked Polyclonal Antibody to Eukaryotic Translation Initiation Factor 4E Binding Protein 1 (EIF4EBP1)

Sign In for Pricing
View Details