Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF415 Rabbit Polyclonal Antibody (HRP)

ZNF415 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Pact, ZfLp

UniProt

Q09FC8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF415

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAFTQLTFRDVAIEFSQDEWKCLNSTQRTLYRDVMLENYRNLVSLDLSRN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Porcine, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_060825

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurotensin Receptor 1 (NTSR1) (NM_002531) Human Over-expression Lysate
LC419265 20 µg

Neurotensin Receptor 1 (NTSR1) (NM_002531) Human Over-expression Lysate

Sign In for Pricing
View Details
Pth2 Mouse Gene Knockout Kit (CRISPR)
KN514186 1 Kit

Pth2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RNF138 (NM_001191324) Human Over-expression Lysate
LY434123 100 µg

RNF138 (NM_001191324) Human Over-expression Lysate

Sign In for Pricing
View Details
CD19 (B-Lymphocyte Marker) (CD19/3117), 0.2mg/mL
BNUB3117-500 1x 500 µL

CD19 (B-Lymphocyte Marker) (CD19/3117), 0.2mg/mL

Sign In for Pricing
View Details
UPP2 Mouse Monoclonal Antibody [Clone ID: OTI11F11]
CF812318 100 µg

UPP2 Mouse Monoclonal Antibody [Clone ID: OTI11F11]

Sign In for Pricing
View Details
LRRTM2 (NM_015564) Human Recombinant Protein
TP720484XL 1 mg

LRRTM2 (NM_015564) Human Recombinant Protein

Sign In for Pricing
View Details