Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF415 Rabbit Polyclonal Antibody (HRP)

ZNF415 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Pact, ZfLp

UniProt

Q09FC8

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF415

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SVRPNLTRHQIIHTGKKPYKCSDCGKSFSVRPNLFRHQIIHTKEKPYKRN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060825

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GIPC2 Polyclonal Antibody
E-AB-65882-01 60 µL

GIPC2 Polyclonal Antibody

Sign In for Pricing
View Details
GIPC2 Polyclonal Antibody
E-AB-65882-02 120 µL

GIPC2 Polyclonal Antibody

Sign In for Pricing
View Details
GIPC2 Polyclonal Antibody
E-AB-65882-03 200 µL

GIPC2 Polyclonal Antibody

Sign In for Pricing
View Details
1X Tris-Glycine-Sodium Dodecyl Sulfate (TG-SDS) Buffer, Ultra Pure Grade, 1L
PB1510-1L 1 L

1X Tris-Glycine-Sodium Dodecyl Sulfate (TG-SDS) Buffer, Ultra Pure Grade, 1L

Sign In for Pricing
View Details
P21 / WAF1 (HJ21), CF640R conjugate, 0.1mg/mL
BNC400984-500 1x 500 µL

P21 / WAF1 (HJ21), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Dystrophin (DMD) (Marker of Duchenne and Becker Muscular Dystrophy) (DMD/3245), 0.2mg/mL
BNUB3245-100 1x 100 µL

Dystrophin (DMD) (Marker of Duchenne and Becker Muscular Dystrophy) (DMD/3245), 0.2mg/mL

Sign In for Pricing
View Details