Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCP1A Rabbit Polyclonal Antibody (FITC)

DCP1A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SMIF, SMAD4IP1, HSA275986, Nbla00360

UniProt

Q9NPI6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DCP1A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDI

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060873

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IPPK Rabbit pAb, PE-Cy7 conjugated
orb2847436 100 µL

IPPK Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
Lentiviral mouse Zc3hav1l shRNA (UAS) - Lentiviral mouse Zc3hav1l shRNA (UAS, iRFP) (25)
GTR15124802 1 Vial

Lentiviral mouse Zc3hav1l shRNA (UAS) - Lentiviral mouse Zc3hav1l shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
GPR142 Polyclonal Antibody
RA25443-01 50 µL

GPR142 Polyclonal Antibody

Sign In for Pricing
View Details
GPR142 Polyclonal Antibody
RA25443-02 100 µL

GPR142 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Milk Fat Globule 1/MFGE8 Antibody Picoband®, Carrier-free
PA1945-carrier-free 100 µg/Vial

Anti-Milk Fat Globule 1/MFGE8 Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
SARS-CoV-2 (2019-nCoV) Spike RBD-mFc (V367F) Recombinant HEK293 Cell Lysate (WB positive control)
MBS8119665-01 0.3 mg

SARS-CoV-2 (2019-nCoV) Spike RBD-mFc (V367F) Recombinant HEK293 Cell Lysate (WB positive control)

Sign In for Pricing
View Details