Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCP1A Rabbit Polyclonal Antibody (HRP)

DCP1A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SMIF, SMAD4IP1, HSA275986, Nbla00360

UniProt

Q9NPI6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DCP1A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDI

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060873

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUD17 Antibody - C-terminal region (ARP48510_P050)
ARP48510_P050 100 µL

NUD17 Antibody - C-terminal region (ARP48510_P050)

Sign In for Pricing
View Details
Indazole-4-carboxylic acid
11011697-1g 1 g

Indazole-4-carboxylic acid

Sign In for Pricing
View Details
Rabbit TNNI1 (Troponin I Type 1, Slow Skeletal) ValidElisa Kit
EK346267 96 Well

Rabbit TNNI1 (Troponin I Type 1, Slow Skeletal) ValidElisa Kit

Sign In for Pricing
View Details
TRNAQ55 ORF Vector (Human) (pORF)
ORF034995 1.0 µg DNA

TRNAQ55 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
SRCRB4D siRNA Oligos set (Human)
45441171 3x 5 nmol

SRCRB4D siRNA Oligos set (Human)

Sign In for Pricing
View Details
1- (2,2-Difluoroethyl) -1H-indazol-3-amine
XZB22821-01 50 mg

1- (2,2-Difluoroethyl) -1H-indazol-3-amine

Sign In for Pricing
View Details