Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCP1A Rabbit Polyclonal Antibody (HRP)

DCP1A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SMIF, SMAD4IP1, HSA275986, Nbla00360

UniProt

Q9NPI6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DCP1A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDI

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060873

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glutathione Peroxidase 1 (GPX1) Human qPCR Template Standard (NM_201397)
HK212552 1 Kit

Glutathione Peroxidase 1 (GPX1) Human qPCR Template Standard (NM_201397)

Sign In for Pricing
View Details
Human ADGRG1-Strep full length protein-synthetic nanodisc
MBS1883266-01 0.01 mg

Human ADGRG1-Strep full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Human ADGRG1-Strep full length protein-synthetic nanodisc
MBS1883266-02 0.05 mg

Human ADGRG1-Strep full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Human ADGRG1-Strep full length protein-synthetic nanodisc
MBS1883266-03 0.1 mg

Human ADGRG1-Strep full length protein-synthetic nanodisc

Sign In for Pricing
View Details
DYNLL2 Antibody
15-250 100 µL

DYNLL2 Antibody

Sign In for Pricing
View Details
CBL Rabbit Polyclonal Antibody (BF488)
orb2413207 100 µL

CBL Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details