Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MDS032 Rabbit Polyclonal Antibody (FITC)

MDS032 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

D12, P31, SLT1, MDS032

UniProt

Q9NZ43

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MDS032

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ELNLVRLLSRCEAMAAEKRDPDEWRLEKYVGALEDMLQALKVHASKPASE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Yeast, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_060937

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIMS4 (Regulating Synaptic Membrane Exocytosis Protein 4, RIM4 gamma, Rab3-interacting Molecule 4, RIM 4, RIMS4, C20orf190) (MaxLight 490) discontinued
302702-ML490 100 µL

RIMS4 (Regulating Synaptic Membrane Exocytosis Protein 4, RIM4 gamma, Rab3-interacting Molecule 4, RIM 4, RIMS4, C20orf190) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Recombinant Ustilago maydis Autophagy-related protein 8 (ATG8)
MBS1383573-01 0.02 mg (E-Coli)

Recombinant Ustilago maydis Autophagy-related protein 8 (ATG8)

Sign In for Pricing
View Details
Recombinant Ustilago maydis Autophagy-related protein 8 (ATG8)
MBS1383573-02 0.1 mg (E-Coli)

Recombinant Ustilago maydis Autophagy-related protein 8 (ATG8)

Sign In for Pricing
View Details
Recombinant Ustilago maydis Autophagy-related protein 8 (ATG8)
MBS1383573-03 0.02 mg (Yeast)

Recombinant Ustilago maydis Autophagy-related protein 8 (ATG8)

Sign In for Pricing
View Details
Recombinant Ustilago maydis Autophagy-related protein 8 (ATG8)
MBS1383573-04 0.1 mg (Yeast)

Recombinant Ustilago maydis Autophagy-related protein 8 (ATG8)

Sign In for Pricing
View Details
Recombinant Ustilago maydis Autophagy-related protein 8 (ATG8)
MBS1383573-05 0.02 mg (Baculovirus)

Recombinant Ustilago maydis Autophagy-related protein 8 (ATG8)

Sign In for Pricing
View Details