Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USE1 Rabbit Polyclonal Antibody (FITC)

USE1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

D12, P31, SLT1, MDS032

UniProt

Q9NZ43

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human USE1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DQNLEKLKTESERLEQHTQKSVNWLLWAMLIIVCFIFISMILFIRIMPKL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060937

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR4537 Protein Vector (Human) (pPM-C-HA)
PV097816 500 ng

MIR4537 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
BAF312 (Siponimod)
B3225-100 100 mg

BAF312 (Siponimod)

Sign In for Pricing
View Details
Belvarafenib TFA
orb1685846 200 mg

Belvarafenib TFA

Sign In for Pricing
View Details
CD117 (CD117 Antigen, c Kit, c-Kit, KIT, Mast/stem Cell Growth Factor Receptor, PBT, Proto-oncogene Tyrosine Protein Kinase Kit, Stem Cell Factor Receptor, SCF Receptor, SCFR, v-Kit Hardy Zuckerman 4 Feline Sarcoma Viral Oncogene Homolog) (MaxLight 650) discontinued
C2448-05E-ML650 100 µL

CD117 (CD117 Antigen, c Kit, c-Kit, KIT, Mast/stem Cell Growth Factor Receptor, PBT, Proto-oncogene Tyrosine Protein Kinase Kit, Stem Cell Factor Receptor, SCF Receptor, SCFR, v-Kit Hardy Zuckerman 4 Feline Sarcoma Viral Oncogene Homolog) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Rabbit Complement 3 ELISA Kit
orb409913-01 24 Tests

Rabbit Complement 3 ELISA Kit

Sign In for Pricing
View Details
Rabbit Complement 3 ELISA Kit
orb409913-02 48 Tests

Rabbit Complement 3 ELISA Kit

Sign In for Pricing
View Details