Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USE1 Rabbit Polyclonal Antibody (HRP)

USE1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

D12, P31, SLT1, MDS032

UniProt

Q9NZ43

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human USE1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DQNLEKLKTESERLEQHTQKSVNWLLWAMLIIVCFIFISMILFIRIMPKL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060937

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

REXO1 Polyclonal Antibody
BT-AP07766-01 20 µL

REXO1 Polyclonal Antibody

Sign In for Pricing
View Details
REXO1 Polyclonal Antibody
BT-AP07766-02 50 µL

REXO1 Polyclonal Antibody

Sign In for Pricing
View Details
REXO1 Polyclonal Antibody
BT-AP07766-03 100 µL

REXO1 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Prohibitin Antibody (SPM311) [PerCP]
NBP3-08722PCP 0.1 mL

Mouse Monoclonal Prohibitin Antibody (SPM311) [PerCP]

Sign In for Pricing
View Details
Human C1q and Tumor Necrosis Factor Related Protein 9 (C1QTNF9) ELISA Kit
MBS2611815-01 48 Well

Human C1q and Tumor Necrosis Factor Related Protein 9 (C1QTNF9) ELISA Kit

Sign In for Pricing
View Details
Human C1q and Tumor Necrosis Factor Related Protein 9 (C1QTNF9) ELISA Kit
MBS2611815-02 96 Well

Human C1q and Tumor Necrosis Factor Related Protein 9 (C1QTNF9) ELISA Kit

Sign In for Pricing
View Details