Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDM5 Rabbit Polyclonal Antibody (FITC)

PRDM5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BCS2, PFM2

UniProt

Q9NQX1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PRDM5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MGLYTARRVRKGEKFGPFAGEKRMPEDLDENMDYRLMWEVRGSKGEVLYI

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

12kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRKAA1 (Protein Kinase, AMP-Activated, alpha 1 Catalytic Subunit, AMPK, AMPKa1, MGC33776, MGC57364) (MaxLight 650)
MBS6229405-01 0.1 mL

PRKAA1 (Protein Kinase, AMP-Activated, alpha 1 Catalytic Subunit, AMPK, AMPKa1, MGC33776, MGC57364) (MaxLight 650)

Sign In for Pricing
View Details
PRKAA1 (Protein Kinase, AMP-Activated, alpha 1 Catalytic Subunit, AMPK, AMPKa1, MGC33776, MGC57364) (MaxLight 650)
MBS6229405-02 5x 0.1 mL

PRKAA1 (Protein Kinase, AMP-Activated, alpha 1 Catalytic Subunit, AMPK, AMPKa1, MGC33776, MGC57364) (MaxLight 650)

Sign In for Pricing
View Details
Monoclonal Antibody to Cluster Of Differentiation 147 (CD147)
TRV-0039979-01 20 µL

Monoclonal Antibody to Cluster Of Differentiation 147 (CD147)

Sign In for Pricing
View Details
Monoclonal Antibody to Cluster Of Differentiation 147 (CD147)
TRV-0039979-02 100 µL

Monoclonal Antibody to Cluster Of Differentiation 147 (CD147)

Sign In for Pricing
View Details
Monoclonal Antibody to Cluster Of Differentiation 147 (CD147)
TRV-0039979-03 200 µL

Monoclonal Antibody to Cluster Of Differentiation 147 (CD147)

Sign In for Pricing
View Details
Monoclonal Antibody to Cluster Of Differentiation 147 (CD147)
TRV-0039979-04 1 mL

Monoclonal Antibody to Cluster Of Differentiation 147 (CD147)

Sign In for Pricing
View Details