Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLHL4 Rabbit Polyclonal Antibody (Biotin)

KLHL4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

KHL4, DKELCHL

UniProt

Q9C0H6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KLHL4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CLQQEGYEHRGTPVQGRLKSHSRDRNGLKKSNSPVHHNILAPVPGPAPAH

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_061990

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDH-CMV-DKK3EF1A-EGFP-T2A-PURO
BZ0606-2 1 Vial

PCDH-CMV-DKK3EF1A-EGFP-T2A-PURO

Sign In for Pricing
View Details
HOXD10 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-22037R-BF488 100 µL

HOXD10 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
RORC (Nuclear Receptor ROR-gamma, Nuclear Receptor RZR-gamma, Nuclear Receptor Subfamily 1 Group F Member 3, Retinoid-related Orphan Receptor-gamma, NR1F3, RORG, RZRG) (Biotin)
MBS6392828-01 0.1 mL

RORC (Nuclear Receptor ROR-gamma, Nuclear Receptor RZR-gamma, Nuclear Receptor Subfamily 1 Group F Member 3, Retinoid-related Orphan Receptor-gamma, NR1F3, RORG, RZRG) (Biotin)

Sign In for Pricing
View Details
RORC (Nuclear Receptor ROR-gamma, Nuclear Receptor RZR-gamma, Nuclear Receptor Subfamily 1 Group F Member 3, Retinoid-related Orphan Receptor-gamma, NR1F3, RORG, RZRG) (Biotin)
MBS6392828-02 5x 0.1 mL

RORC (Nuclear Receptor ROR-gamma, Nuclear Receptor RZR-gamma, Nuclear Receptor Subfamily 1 Group F Member 3, Retinoid-related Orphan Receptor-gamma, NR1F3, RORG, RZRG) (Biotin)

Sign In for Pricing
View Details
Eukaryotic Translation Initiation Factor 2 Alpha Kinase 2 (EIF2AK2) Antibody
abx330406 100 µL

Eukaryotic Translation Initiation Factor 2 Alpha Kinase 2 (EIF2AK2) Antibody

Sign In for Pricing
View Details
NAGase (N-Acetyl Beta-D-Glucosaminidase, MGEA5, MEA5, NCOAT, Hexosaminidase C, N-Acetylhexosaminidase, Hyaluronidase, Meningioma-Expressed Antigen 5, Nuclear Cytoplasmic O-GlcNAcase And Acetyltransferase)
364289 200 µL

NAGase (N-Acetyl Beta-D-Glucosaminidase, MGEA5, MEA5, NCOAT, Hexosaminidase C, N-Acetylhexosaminidase, Hyaluronidase, Meningioma-Expressed Antigen 5, Nuclear Cytoplasmic O-GlcNAcase And Acetyltransferase)

Sign In for Pricing
View Details