Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wdr45l Rabbit Polyclonal Antibody (FITC)

Wdr45l Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

WIPI-3, Wdr45l, RGD1305141

UniProt

Q2MCP5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Wdr45l

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SPCICAFGTEPNAVIAICADGSYYKFLFSPKGECVRDVCAQFLEMTDDKL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001034676

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LDB2 Peptide
orb2020516 100 µg

LDB2 Peptide

Sign In for Pricing
View Details
Pig porcine BMP-5 ELISA Kit PicoKine®, Carrier-free
EK0310-PO-carrier-free 96 Well With Removable Strips

Pig porcine BMP-5 ELISA Kit PicoKine®, Carrier-free

Sign In for Pricing
View Details
FACL4 monoclonal antibody
orb1723086-01 50 µL

FACL4 monoclonal antibody

Sign In for Pricing
View Details
FACL4 monoclonal antibody
orb1723086-02 100 µL

FACL4 monoclonal antibody

Sign In for Pricing
View Details
Recombinant Human metapneumovirus Major surface glycoprotein G (G), partial
CSB-EP754440HDAM1-01 20 µg

Recombinant Human metapneumovirus Major surface glycoprotein G (G), partial

Sign In for Pricing
View Details
Recombinant Human metapneumovirus Major surface glycoprotein G (G), partial
CSB-EP754440HDAM1-02 100 µg

Recombinant Human metapneumovirus Major surface glycoprotein G (G), partial

Sign In for Pricing
View Details