Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POLE4 Rabbit Polyclonal Antibody (HRP)

POLE4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P12, YHHQ1

UniProt

Q9NR33

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human POLE4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAAAAAAGSGTPREEEGPAGEAAASQPQAPTSVPGARLSRLPLARVKALV

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

12kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_063949

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Chaetomium globosum Exportin-T (LOS1), partial
MBS1296423 Inquire

Recombinant Chaetomium globosum Exportin-T (LOS1), partial

Sign In for Pricing
View Details
Glucose Regulated Protein 75 (Grp75, HSPA9, heat shock 70kDa protein 9 (mortalin), CSA, HSPA9B, MGC4500, Mortalin, MOT, MOT2, mot-2, mthsp75, MTHSP75, PBP74, Peptide-binding protein 74, Stress-70 protein, mitochondrial) discontinued
389589-01 20 µL

Glucose Regulated Protein 75 (Grp75, HSPA9, heat shock 70kDa protein 9 (mortalin), CSA, HSPA9B, MGC4500, Mortalin, MOT, MOT2, mot-2, mthsp75, MTHSP75, PBP74, Peptide-binding protein 74, Stress-70 protein, mitochondrial) discontinued

Sign In for Pricing
View Details
Glucose Regulated Protein 75 (Grp75, HSPA9, heat shock 70kDa protein 9 (mortalin), CSA, HSPA9B, MGC4500, Mortalin, MOT, MOT2, mot-2, mthsp75, MTHSP75, PBP74, Peptide-binding protein 74, Stress-70 protein, mitochondrial) discontinued
389589-02 200 µL

Glucose Regulated Protein 75 (Grp75, HSPA9, heat shock 70kDa protein 9 (mortalin), CSA, HSPA9B, MGC4500, Mortalin, MOT, MOT2, mot-2, mthsp75, MTHSP75, PBP74, Peptide-binding protein 74, Stress-70 protein, mitochondrial) discontinued

Sign In for Pricing
View Details
Recombinant Bacillus subtilis UPF0382 membrane protein ywdK (ywdK)
MBS7035609-01 0.02 mg

Recombinant Bacillus subtilis UPF0382 membrane protein ywdK (ywdK)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis UPF0382 membrane protein ywdK (ywdK)
MBS7035609-02 0.1 mg

Recombinant Bacillus subtilis UPF0382 membrane protein ywdK (ywdK)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis UPF0382 membrane protein ywdK (ywdK)
MBS7035609-03 5x 0.1 mg

Recombinant Bacillus subtilis UPF0382 membrane protein ywdK (ywdK)

Sign In for Pricing
View Details