Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC2A4RG Rabbit Polyclonal Antibody (Biotin)

SLC2A4RG Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

GEF, HDBP1, HDBP-1, Si-1-2, Si-1-2-19

UniProt

Q9NR83

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SLC2A4RG

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: HSDRVYQGCLTPARLEPQPTEVGACPPALSSRIGVTLRKPRGDAKKCRKV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N4BP2L2 Mouse Monoclonal Antibody [Clone ID: LBI7F5]
AMM16361VCF 100 µg

N4BP2L2 Mouse Monoclonal Antibody [Clone ID: LBI7F5]

Sign In for Pricing
View Details
LOC68395 3'UTR GFP Stable Cell Line
TU162515 1.0 mL

LOC68395 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Vmn1r42 siRNA Oligos set (Mouse)
49668174 3x 5 nmol

Vmn1r42 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
TSSK6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
48652061 1.0 µg DNA

TSSK6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Mouse Fibroblast Growth Factor 1, Acidic (FGF1) ELISA Kit
EK14006 48 Tests

Mouse Fibroblast Growth Factor 1, Acidic (FGF1) ELISA Kit

Sign In for Pricing
View Details
NUF2 Antibody
MBS9403662-01 0.1 mL

NUF2 Antibody

Sign In for Pricing
View Details